Protease Inhibitors and Phosphatase Inhibitors
MilliporeSigma™ Calbiochem™ HSP90 Inhibitor, CCT018159
The HSP90 Inhibitor, CCT018159, also referenced under CAS 171009-07-7, controls the biological activity of HSP90.
MilliporeSigma™ Calbiochem™ Retro-2
A cell-permeable tricyclic imine compound that inhibits the endosome-to-Golgi retrograde transport, but not cellular uptake, of CtxB, StxB without affecting cellular uptake/trafficking of Tf or EGF.
MilliporeSigma™ Calbiochem™ InSolution™ TAPI-2
A 10 mM (1 mg/241 μL) sterile-filtered solution of TAPI-2 in H2O.
MilliporeSigma™ Calbiochem™ Ellagic Acid, Dihydrate
A cell-permeable, reversible, potent antioxidant that has anti-mutagenic and anti-carcinogenic properties.
MilliporeSigma™ Calbiochem™ Golgicide A
A cell-permeable quinoline compound that selectively targets ArfGEF GBF1, but not BIG1/2, and attenuates GBF1-mediated cellular vesicle traffickings in a reversible manner.
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ p53-Snail binding Inhibitor, GN25
The p53-Snail binding Inhibitor, GN25 controls the biological activity of p53-Snail. This small molecule/inhibitor is primarily used for Neuroscience applications.
MilliporeSigma™ Calbiochem™ Glucagon-Like Peptide 1 Receptor Agonist II
A pyrimidine small molecule that acts as a GLP-1 allosteric agonist that induces cAMP signaling in HEK293 cells expressing the GLP-1 receptor with EC50
MilliporeSigma™ Calbiochem™ Calpain Inhibitor VI
The Calpain Inhibitor VI, also referenced under CAS 190274-53-4, controls the biological activity of Calpain. This small molecule/inhibitor is primarily used for Protease Inhibitors applications.
MilliporeSigma™ Calbiochem™ Ro-31-8220
A cell-permeable, reversible, competitive, and selective inhibitor of protein kinase C (PKC; IC50 = 10 nM) over CaM kinase II (IC50 = 17 μM) and protein kinase A (IC50 = 900 nM).
MilliporeSigma™ Calbiochem™ ApoE4 Modulator, PH002
A phthalazinone derived compound that directly binds to the 22-kDa amino-terminal region of apolipoprotein E4 (ApoE4) and blocks its intramolecular domain interactions in neuronal cells thereby reversing the detrimental effects of ApoE4.
MilliporeSigma™ Calbiochem™ InSolution™ GSK-3 Inhibitor XVI, CHIR99021
InSolution™ GSK-3 Inhibitor XVI, CHIR99021, CAS 252917-06-9, is a 25 mM solution in DMSO. A cell-permeable, ATP-competitive inhibitor of GSK-3 (IC50 = 10 & 6.7 nM for GSK-3α and GSK-3β, respectively).
MilliporeSigma™ Calbiochem™ LDN-211904
LDN-211904 modulates the biological activity of EphB3 receptor tyrosine kinase. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ InSolution™ Y-27632
Y-27632A, CAS 146986-50-7, is a cell-permeable, reversible, inhibitor of Rho kinases (Ki = 140 nM for p160ROCK). Enhances survival & cloning efficiency of ESC without affecting their pluripotency.